.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ycy

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein Pfu-1806301-001 from Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 1ycy Target Id Pfu-1806301-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9342, Molecular Weight 7969.88 Da.
    Residues 71 Isoelectric Point 4.62
    Sequence mgmesllekvlkewkghkvavsvggdhsftgtledfdeevillkdvvdvignrgkqmligledinwiml le
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.80 Rfree 0.311
    Matthews' coefficent 2.89 Rfactor 0.281
    Waters Solvent Content 57.37

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch