.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yd7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein Pfu-1647980-001 from Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 1yd7 Target Id Pfu-1647980-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9344, Molecular Weight 43129.36 Da.
    Residues 387 Isoelectric Point 5.26
    Sequence mnkrfpfpvgepdfiqgdeaiaraailagcrfyagypitpaseifeamalymplvdgvviqmedeiasi aaaigaswagakamtatsgpgfslmqenigyavmtetpvvivdvqrsgpstgqptlpaqgdimqaiwgt hgdhslivlspstvqeafdftirafnlsekyrtpvilltdaevghmrervyipnpdeieiinrklprne eeaklpfgdphgdgvppmpifgkgyrtyvtglthdekgrprtvdrevherlikrivekieknkkdifty etyeledaeigvvatgivarsalravkmlreegikagllkietiwpfdfelieriaervdklyvpemnl gqlyhlikegangkaevkliskiggevhtpmeifefirrefk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.24274
    Matthews' coefficent Rfactor 0.20586
    Waters 25 Solvent Content

    Ligand Information
    Ligands UNX (UNKNOWN) x 6
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch