The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site SECSG
    PDB Id 1ye7 Target Id Tth-0235
    Molecular Characteristics
    Source Thermus thermophilus
    Alias Ids TPS9308, Molecular Weight 25188.45 Da.
    Residues 236 Isoelectric Point 6.56
    Sequence mghhhhhhhhhhssghiddddkhmevsvlipaagnglrlgrgpkaflqvggrtllewtlaafrdaaevl valppgaeppkglgavfleggatrqasvarlleaaslplvlvhdvarpfvsrglvarvleaaqrsgaav pvlpvpdtlmapegeaygrvvpreafrlvqtpqgfftallreahayarrkgleasddaqlvqalgypva lvegeatafkithpqdlvlaealarvwsa
      BLAST   FFAS

    Structure Determination
    Method Chains
    Resolution (Å) Rfree
    Matthews' coefficent Rfactor
    Waters Solvent Content

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch