The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Conserved hypothetical protein Pfu-838710-001 from Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 1yem Target Id Pfu-838710-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9298, Molecular Weight 20416.41 Da.
    Residues 171 Isoelectric Point 4.93
    Sequence meveikfkikledflhtlntfnpefvryeeqedvyfevprpkllrirgvhnlkkyyltfkeildennee fyevefeigdfekavevfkrlgfkiqatikkkrwvyklngvtlevnrvegigdfvdievisdspeeake kiwevakmlglkeedveprlylelinelsgrss
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.30 Rfree 0.2578
    Matthews' coefficent 4.05 Rfactor 0.2228
    Waters 17 Solvent Content 69.59

    Ligand Information
    Ligands UNX (UNKNOWN) x 7
    Metals PT (PLATINUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch