The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the putative Carbonyl Reductase Sniffer of Caenorhabditis elegans. To be Published
    Site SECSG
    PDB Id 1yo6 Target Id C55A6.5
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9293, Molecular Weight 26701.12 Da.
    Residues 250 Isoelectric Point 8.85
    Sequence mspgsvvvtganrgiglglvqqlvkdknirhiiatardvekatelksikdsrvhvlpltvtcdksldtf vskvgeivgsdglsllinnagvllsygtntepnraviaeqldvnttsvvlltqkllpllknaaskesgd qlsvsraavitissglgsitdntsgsaqfpvlayrmskaainmfgrtlavdlkddnvlvvnfcpgwvqt nlggknaaltveqstaelissfnkldnshngrffmrnlkpyef
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 2.60 Rfree 0.286
    Matthews' coefficent 2.40 Rfactor 0.218
    Waters 236 Solvent Content 48.80

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch