.
The Open Protein Structure Annotation Network
PDB Keyword
.

2f8p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of obelin after Ca2+-triggered bioluminescence suggests neutral coelenteramide as the primary excited state. Proc.Natl.Acad.Sci.Usa 103 2570-2575 2006
    Site SECSG
    PDB Id 2f8p Target Id Cadis-obelin
    Molecular Characteristics
    Source Obelia longissima
    Alias Ids TPS9327, Molecular Weight 22208.74 Da.
    Residues 195 Isoelectric Point 4.89
    Sequence maskyavklktdfdnprwikrhkhmfdfldingngkitldeivskasddicakleatpeqtkrhqvcve affrgcgmeygkeiafpqfldgwkqlatselkkwarneptlirewgdavfdifdkdgsgtitldewkay gkisgispsqedcestfrhcdldnagdldvdemtrqhlgfwytldpeadglygngvp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.93 Rfree 0.22997
    Matthews' coefficent 2.95 Rfactor 0.19043
    Waters 136 Solvent Content 58.24

    Ligand Information
    Ligands CEI (N-[3-BENZYL-5-(4-HYDROXYPHENYL)PYRAZIN-2-YL]-2-(4-) x 1
    Metals CA (CALCIUM) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch