The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical Protein Pfu-1136390-001 From Pyrococcus furiosus. To be published
    Site SECSG
    PDB Id 2fzf Target Id Pfu-1136390-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9315, Molecular Weight 20838.31 Da.
    Residues 176 Isoelectric Point 5.24
    Sequence mgstiqevreglpiekmadfsleellgmaikaeigarefykslaekikiealkekinwlaeeekkheal lrklysqmfpgkevvfpkehigpelqpvarelekvqdiidlirwamkaeeiaaefylkleemvkeeekk rlmryladmerghyytlraeyelllnwemysqmmhigp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.299
    Matthews' coefficent 2.34 Rfactor 0.248
    Waters 50 Solvent Content 47.46

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch