.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hjm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a singleton protein PF1176 from P. furiosus. To be Published
    Site SECSG
    PDB Id 2hjm Target Id PF1176
    Molecular Characteristics
    Source Pyrococcus furiosus dsm 3638
    Alias Ids TPS9319, Molecular Weight 11104.30 Da.
    Residues 97 Isoelectric Point 5.11
    Sequence mdlvekvkelcleleeenlakaierfitlthgiektrgeafakasiygflegilttlkmkysnekietl lnevktareeteallrkprppllvdndl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.90 Rfree 0.2789
    Matthews' coefficent 2.33 Rfactor 0.2276
    Waters 2 Solvent Content 47.26

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch