.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hq1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of ORF 1438 a putative Glucose/ ribitol dehydrogenase from Clostridium thermocellum. To be Published
    Site SECSG
    PDB Id 2hq1 Target Id Cth-1438
    Molecular Characteristics
    Source Clostridium thermocellum
    Alias Ids TPS9350, Molecular Weight 26076.80 Da.
    Residues 247 Isoelectric Point 8.90
    Sequence mqlkgktaivtgssrglgkaiawklgnmganivlngspastsldataeefkaaginvvvakgdvknped venmvktamdafgridilvnnagitrdtlmlkmsekdwddvlntnlksaylctkavskimlkqksgkii nitsiagiignagqanyaaskagligftksiakefaakgiycnavapgiiktdmtdvlpdkvkemylnn iplkrfgtpeevanvvgflasddsnyitgqvinidgglvm
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.90 Rfree 0.24902
    Matthews' coefficent 2.59 Rfactor 0.23235
    Waters 54 Solvent Content 52.57

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch