The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of ORF 1580 a hypothetical protein from Pyrococcus horikoshii. To be Published
    Site SECSG
    PDB Id 2hq4 Target Id PH1580
    Molecular Characteristics
    Source Pyrococcus horikoshii shinkaj ot3
    Alias Ids TPS9312, Molecular Weight 18388.51 Da.
    Residues 152 Isoelectric Point 5.50
    Sequence mqceeklevfengfkdekfnvevkfygndarkvllamiyelylpeygreyvypfecakefwniylegee iqdeefqlkpikftseqvikklqeeikkikppleikieeakiyktkegylavgnyfildprgrlfifnk psiankilkyiwkw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.99 Rfree 0.23184
    Matthews' coefficent 2.81 Rfactor 0.19456
    Waters 214 Solvent Content 56.18

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch