The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of coelenterazine-binding protein from Renilla muelleri at 1.7 A: why it is not a calcium-regulated photoprotein. PHOTOCHEM.PHOTOBIOL.SCI. 7 442-447 2008
    Site SECSG
    PDB Id 2hq8 Target Id CBP+Ca
    Molecular Characteristics
    Source Renilla muelleri
    Alias Ids TPS9336, Molecular Weight 20828.53 Da.
    Residues 186 Isoelectric Point 4.61
    Sequence mpeiteserayhlrkmktrmqrvdvtgdgfisredyeliavriakiaklsaekaeetrqeflrvadqlg lapgvrisveeaavnatdsllkmkgeekamaviqslimydcidtdkdgyvslpefkaflqavgpdltdd kaitcfntldfnkngqisrdeflvtvndflfgleetalanafygdlvd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.24747
    Matthews' coefficent 2.66 Rfactor 0.20473
    Waters 300 Solvent Content 53.75

    Ligand Information
    Metals CA (CALCIUM) x 6



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch