The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of a large fragment of the Human P100 Tudor Domain. To be Published
    Site SECSG
    PDB Id 2hqe Target Id Hsa-P100-TDS
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS9334, Molecular Weight 11483.38 Da.
    Residues 101 Isoelectric Point 6.13
    Sequence vqdvetgtqfqklmenmrndiashppvegsyaprrgefciakfvdgewyrarvekvespakihvfyidy gnrevlpstrlgtlspafstrvlpaqateyaf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.24919
    Matthews' coefficent 1.99 Rfactor 0.23338
    Waters 156 Solvent Content 38.10

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch