.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hqx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Human P100 Tudor Domain Conserved Region. To be Published
    Site SECSG
    PDB Id 2hqx Target Id Hsa-P100-TDL
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS9335, Molecular Weight 27906.92 Da.
    Residues 246 Isoelectric Point 4.94
    Sequence pveevmpvleekersasykpvfvteitddlhfyvqdvetgtqfqklmenmrndiashppvegsyaprrg efciakfvdgewyrarvekvespakihvfyidygnrevlpstrlgtlspafstrvlpaqateyafafiq vpqdddartdavdsvvrdiqntqcllnvehlsagcphvtlqfadskgdvglglvkeglvmvevrkekqf qkviteylnaqesaksarlnlwrygdfraddadefgysr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.42 Rfree 0.27042
    Matthews' coefficent Rfactor 0.22947
    Waters 238 Solvent Content

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch