.
The Open Protein Structure Annotation Network
PDB Keyword
.

2hr5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of iron bound Rubrerythrin from Pyrococcus Furiosus. To be Published
    Site SECSG
    PDB Id 2hr5 Target Id Pfu-1210814-002
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9359, Molecular Weight 19499.54 Da.
    Residues 171 Isoelectric Point 5.67
    Sequence mvvkrtmtkkfleeafagesmahmrylifaekaeqegfpniaklfraiayaefvhaknhfialgklgkt penlqmgiegetfeveemypvynkaaefqgekeavrtthyaleaekihaelyrkakekaekgedieikk vyicpicgytavdeapeycpvcgapkekfvvfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.70 Rfree 0.247
    Matthews' coefficent 2.85 Rfactor 0.176
    Waters 37 Solvent Content 56.79

    Ligand Information
    Ligands
    Metals FE (FE) x 6

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch