The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Transcriptional Regulatory Protein PF0864: an Asnc Family member from Pyrococcus Furiosus. To be Published
    Site SECSG
    PDB Id 2ia0 Target Id Pfu-839232-001
    Molecular Characteristics
    Source Pyrococcus furiosus
    Alias Ids TPS9316, Molecular Weight 18455.63 Da.
    Residues 162 Isoelectric Point 6.45
    Sequence mseihlddldrnilrllkkdarltiselseqlkkpestihfrikklqergvierytiilgeqlkpkhla livlevgkpviedfleryisyisstlsalpgvlfvaksgedkiialvgknnkdelvkfieenitsipnl khiqifpiteikkgedltgflaev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.37 Rfree 0.26854
    Matthews' coefficent 2.52 Rfactor 0.20541
    Waters 97 Solvent Content 51.28

    Ligand Information
    Metals AU (GOLD) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch