.
The Open Protein Structure Annotation Network
PDB Keyword
.

2ic7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Maltose Transacetylase From Geobacillus kaustophilus at 1.78 Angstrom Resolution. To be Published
    Site SECSG
    PDB Id 2ic7 Target Id GK1921-1
    Molecular Characteristics
    Source Geobacillus kaustophilus hta426
    Alias Ids TPS9309, Molecular Weight 20781.73 Da.
    Residues 187 Isoelectric Point 6.48
    Sequence ghmksekekmlaghlynpadlelvkererarrlvrlynetleteydkrtgllkelfgstgerlfiepnf rcdygynihvgenffmnfdgvildvcevrigdhcfigpgvhiytathpldphernsgleygkpvvighn vwiggravinpgvtigdnaviasgavvtkdvpanavvggnpakvikwlk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.78 Rfree 0.206
    Matthews' coefficent 2.74 Rfactor 0.178
    Waters 595 Solvent Content 55.21

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch