The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical Protein YedK From Escherichia coli. To be Published
    Site SECSG
    PDB Id 2icu Target Id Eco-JW1916
    Molecular Characteristics
    Source Escherichia coli k-12
    Alias Ids TPS9368, Molecular Weight 25497.36 Da.
    Residues 229 Isoelectric Point 5.19
    Sequence gssgssgmcgrfaqsqtredylallaedierdipydpepigrynvapgtkvlllserdehlhldpvfwg yapgwwdkpplinarvetaatsrmfkplwqhgraicfadgwfewkkegdkkqpffiyradgqpifmaai gstpfergdeaegflivtaaadqglvdihdrrplvlspeaarewmrqeisgkeaseiaasgcvpanqfs whpvsravgnvknqgaeliqpv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.20319
    Matthews' coefficent 2.27 Rfactor 0.1726
    Waters 749 Solvent Content 45.82

    Ligand Information



    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch