The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Hypothetical Protein AF0160 from Archaeoglobus fulgidus at 2.69 Angstrom resolution. To be Published
    Site SECSG
    PDB Id 2idg Target Id AF0160
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm4304
    Alias Ids TPS9341, Molecular Weight 20238.23 Da.
    Residues 174 Isoelectric Point 5.99
    Sequence mtigrakvyatlskifyhlfydeaipkdcreiiekfgeidfnlrsvlvrelrgsvlikdmpqslaevye svmkdfyerygfqaselhadhiavelafmsklvereislaqqmkeeelykiraaqhrfikahlqplvkn lpsapllnfvrdfvredakylysslvgeknegadnn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.69 Rfree 0.29677
    Matthews' coefficent 2.59 Rfactor 0.24394
    Waters 81 Solvent Content 52.60

    Ligand Information



    Protein Summary


    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch