.
The Open Protein Structure Annotation Network
PDB Keyword
.

2iel

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title CRYSTAL STRUCTURE OF TT0030 from Thermus Thermophilus AT 1.6 ANGSTROMS RESOLUTION. To be Published
    Site SECSG
    PDB Id 2iel Target Id TT0030
    Molecular Characteristics
    Source Thermus thermophilus hb27
    Alias Ids TPS9346, Molecular Weight 15047.51 Da.
    Residues 138 Isoelectric Point 5.59
    Sequence marylvvahrtakspelaaklkellaqdpearfvllvpavpppgwvyeenevrrraeeeaaaakralea qgipveeakagdispllaieeellahpgayqaivlstlppgpsrwlrldvhtqaerfglpvihviaqaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.2791
    Matthews' coefficent 2.15 Rfactor 0.25664
    Waters 173 Solvent Content 42.94

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch