.
The Open Protein Structure Annotation Network
PDB Keyword
.

1r75

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title LEISHMANIA MAJOR HYPOTHETICAL PROTEIN. To be Published
    Site SGPP
    PDB Id 1r75 Target Id Lmaj002144AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14919,LMJF20.1230 Molecular Weight 16205.30 Da.
    Residues 141 Isoelectric Point 5.43
    Sequence mahhhhhhmgsriskeaapvtfkngkptvkgtktypmfsnilyriadtearrwafyndskeliihvavl fdydsqivplgdttafriddpdegneddfgkylcevdvrpletqmfvegsvtgwrvdtleartaederg yrl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.86 Rfree 0.228
    Matthews' coefficent 2.43 Rfactor 0.201
    Waters 105 Solvent Content 49.34

    Ligand Information
    Ligands GOL (GLYCEROL) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch