.
The Open Protein Structure Annotation Network
PDB Keyword
.

1syr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Initial Structural Analysis of Plasmodium falciparum thioredoxin. To be Published
    Site SGPP
    PDB Id 1syr Target Id Pfal007201AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14894,PF14_0545 Molecular Weight 12740.92 Da.
    Residues 112 Isoelectric Point 5.61
    Sequence mahhhhhhmvkivtsqaefdsiisqnelvivdffaewcgpckriapfyeecsktytkmvfikvdvdevs evtekenitsmptfkvykngssvdtllgandsalkqliekyaa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.95 Rfree 0.23616
    Matthews' coefficent 3.50 Rfactor 0.19677
    Waters Solvent Content 65.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch