.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tqx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a ribulose 5-phosphate 3-epimerase from Plasmodium falciparum. Proteins 62 338-342 2006
    Site SGPP
    PDB Id 1tqx Target Id Pfal009167AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14899,PFL0960W Molecular Weight 26572.42 Da.
    Residues 235 Isoelectric Point 6.45
    Sequence mahhhhhhmgtlkaiiapsvlasnisklaeetqrmeslgaewihldvmdmhfvpnlsfgppvinnlkky tksiffdvhlmveypekyvpllktsnqltfhfealnedterciqlakeirdnnlwcgisikpktdvqkl vpildtnlintvlvmtvepgfggqsfmhdmmgkvsflrkkyknlniqvdgglnietteisashganiiv agtsifnaedpkyvidtmrvsvqkylnn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.233
    Matthews' coefficent 3.96 Rfactor 0.212
    Waters 242 Solvent Content 69.00

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals ZN (ZINC) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch