The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Designed protein based on backbone conformation of procarboxypeptidase-A (1AYE) with sidechains chosen for maximal predicted stability. To be Published
    Site SGPP
    PDB Id 1vjq Target Id DBsf000001AYE
    Molecular Characteristics
    Source David baker superfolder
    Alias Ids TPS14916, Molecular Weight 9029.88 Da.
    Residues 79 Isoelectric Point 4.03
    Sequence ktifvivptneeqvaflealakqdelnfdwqnpptepgqpvvilipsdmvewflemlkakgipftvyve eggsenlyfq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.2906
    Matthews' coefficent 2.14 Rfactor 0.1991
    Waters 66 Solvent Content 42.52

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch