.
The Open Protein Structure Annotation Network
PDB Keyword
.

1vju

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Coproporphyrinogen III oxidase from Leishmania major. To be Published
    Site SGPP
    PDB Id 1vju Target Id Lmaj006828AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14918,LMJF06.1270 Molecular Weight 35393.16 Da.
    Residues 309 Isoelectric Point 5.76
    Sequence mahhhhhhmslaveavkdfllklqddicealeaedgqatfvedkwtregggggrtrvmvdgaviekggv nfshvygkglpmssterhpdiagcnfeamgvslvihpknphvptshanvrlfvaeregkepvwwfgggf dltpyyaveedcrdfhqvaqdlckpfgadvyarfkgwcdeyffipyrneargigglffddlnewpfekc fefvqavgkgymdayipivnrrkntpyteqqvefqefrrgryaefnlvidrgtkfglqsggrtesilis lpprarwgynwqpepgtpearlteyfltkrqwv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.1804
    Matthews' coefficent 2.40 Rfactor 0.1514
    Waters 644 Solvent Content 48.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch