.
The Open Protein Structure Annotation Network
PDB Keyword
.

1x6o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Analysis of Leishmania braziliensis eukaryotic initiation factor 5a. To be Published
    Site SGPP
    PDB Id 1x6o Target Id Lbra003024AAA
    Molecular Characteristics
    Source Leishmania braziliensis
    Alias Ids TPS14903, Molecular Weight 18835.99 Da.
    Residues 174 Isoelectric Point 5.42
    Sequence mahhhhhhmsdedhdfshqgggdnasktyplaagalkkggyvcingrpckvidlsvsktgkhghakvsi vatdiftgnrledqapsthnvevpfvktytysvldiqanedpslpahlslmddegesredldmppdpal atqikeqfdsgkdvlvvvvsamgteqvlqtknaaek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.21398
    Matthews' coefficent 2.90 Rfactor 0.17444
    Waters 325 Solvent Content 56.60

    Ligand Information
    Ligands PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch