.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xo7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of cyclophilin from Trypanosoma cruzi. TO BE PUBLISHED
    Site SGPP
    PDB Id 1xo7 Target Id Tcru013382AAA
    Molecular Characteristics
    Source Trypanosoma cruzi
    Alias Ids TPS14915,TC00.1047053508577.140 Molecular Weight 19058.81 Da.
    Residues 174 Isoelectric Point 8.63
    Sequence mahhhhhhmpvvtdkvyfditigdepvgrvviglfgndvpktvenfkqlasgengfgykgsifhrvirn fmiqggdftnfdgtggksiygtrfddenlkikhfvgavsmanagpnsngsqffvttaptpwldgrhvvf gkvvegmdvvkkventktglndkpkkavkindcgvl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.61 Rfree 0.19774
    Matthews' coefficent 2.38 Rfactor 0.17899
    Waters 808 Solvent Content 48.28

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch