.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xtd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Analysis of Leishmania mexicana eukaryotic initiation factor 5a. To be Published
    Site SGPP
    PDB Id 1xtd Target Id Lmex003024AAA
    Molecular Characteristics
    Source Leishmania mexicana
    Alias Ids TPS14922, Molecular Weight 18852.06 Da.
    Residues 174 Isoelectric Point 5.43
    Sequence mahhhhhhmsdedhdfahqgggdnasktypmaagalkkggyvcingrpckvidlsvsktgkhghakvsi vatdiftgnrledqapsthnvevpfvktftysvldiqpnedpslpshlslmddegesredldmppdaal atqikeqfdsgkevlvvvvsamgteqvlqtknaaek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.30183
    Matthews' coefficent 2.90 Rfactor 0.22054
    Waters 81 Solvent Content 57.40

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch