.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xtp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Analysis of Leishmania major LMAJ004091AAA. To be Published
    Site SGPP
    PDB Id 1xtp Target Id Lmaj004091AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14882,LMJF30.0810 Molecular Weight 28453.85 Da.
    Residues 254 Isoelectric Point 5.91
    Sequence gpgsmpskeassrnlpisgrdtngktyrstdemwkaeltgdlydpekgwygkaleywrtvpatvsgvlg gmdhvhdvdiegsrnfiaslpghgtsraldcgagigritknlltklyattdllepvkhmleeakrelag mpvgkfilasmetatlppntydliviqwtaiyltdadfvkffkhcqqaltpngyiffkencstgdrflv dkedssltrsdihykrlfnesgvrvvkeafqeewptdlfplkmyalk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.94 Rfree 0.21884
    Matthews' coefficent 2.10 Rfactor 0.15313
    Waters 181 Solvent Content 41.00

    Ligand Information
    Ligands SAI (S-ADENOSYL-L-HOMOSELENOCYSTEINE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch