.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y1x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural analysis of a homolog of programmed cell death 6 protein from Leishmania major Friedlin. To be Published
    Site SGPP
    PDB Id 1y1x Target Id Lmaj01134AAC
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14888,LMJF13.1460 Molecular Weight 21669.08 Da.
    Residues 191 Isoelectric Point 6.10
    Sequence mahhhhhhmptstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpfslattekll hmydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraallssgyqvseqtfqalmrkf drqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftfdtfiggsvsil
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.23277
    Matthews' coefficent 2.60 Rfactor 0.18745
    Waters 216 Solvent Content 51.60

    Ligand Information
    Ligands SO4 (SULFATE) x 3
    Metals CA (CALCIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch