The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structural analysis of a probable kinase from Leishmania major Friedlin. To be Published
    Site SGPP
    PDB Id 1y63 Target Id Lmaj004144AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14884,LMJF30.1890 Molecular Weight 21230.82 Da.
    Residues 184 Isoelectric Point 4.58
    Sequence gpgsmeqpkginilitgtpgtgktsmaemiaaeldgfqhlevgklvkenhfyteydteldthiieekde drlldfmepimvsrgnhvvdyhsselfperwfhmvvvlhtstevlferltkrqyseakraenmeaeiqc iceeeardayeddivlvrendtleqmaatveeirervevlkvergl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.19621
    Matthews' coefficent 53.00 Rfactor 0.16492
    Waters 157 Solvent Content 2.63

    Ligand Information
    Metals MN (MANGANESE) x 8;BR (BROMIDE) x 5;NA (SODIUM) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch