The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Site SGPP
    PDB Id 1yzv Target Id Tcru003547AAA
    Molecular Characteristics
    Source Trypanosoma cruzi
    Alias Ids TPS14913,TC00.1047053505945.20 Molecular Weight 22459.99 Da.
    Residues 204 Isoelectric Point 7.68
    Sequence mahhhhhhmsrllkhygscktaffccdiqekfmgrvansancvfvanrfaglhtalgtahsvyvvteqy pkglgatsadirlppdahvfskkrfamlvpevmplvdlpeveqvvlwgfethvcvlqtaaalldmkkkv viavdgcgsqsqgdhctaiqlmqswsgdgcyvstsesilmqllkdasdpvfktvaplmkqthpiri
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.1868
    Matthews' coefficent 3.28 Rfactor 0.1568
    Waters 166 Solvent Content 62.52

    Ligand Information
    Ligands SO4 (SULFATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch