The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical protein from plasmodium berghei. To be published
    Site SGPP
    PDB Id 2a03 Target Id Pber005319AAA
    Molecular Characteristics
    Source Plasmodium berghei
    Alias Ids TPS14908,PB000490.02.0 Molecular Weight 23592.39 Da.
    Residues 206 Isoelectric Point 6.94
    Sequence mahhhhhhmaitlpklkyalnalsphiseetlsfhynkhhagyvnklnglikdtplanksltdilkest gaifnnaaqiwnhsfywdsmgpncggephgeikekiqedfgsfnnfkdqfsnvlcghfgsgwgwlalnk nnklvilqthdagnpikentgipiltcdvwehayyidyrndrlsyvkawwnlvnwnfanenlknalnk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.33 Rfree 0.2017
    Matthews' coefficent 3.51 Rfactor 0.1707
    Waters 256 Solvent Content 64.94

    Ligand Information
    Metals ZN (ZINC) x 1;MN (MANGANESE) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch