.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a0k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Using fragment cocktail crystallography to assist inhibitor design of Trypanosoma brucei nucleoside 2-deoxyribosyltransferase. J.Med.Chem. 49 5939-5946 2006
    Site SGPP
    PDB Id 2a0k Target Id Tbru015777AAA
    Molecular Characteristics
    Source Trypanosoma brucei
    Alias Ids TPS14912,TB927.5.1360 Molecular Weight 18321.97 Da.
    Residues 161 Isoelectric Point 6.15
    Sequence mahhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatgaldirqkniqmikdcd aviadlspfrghepdcgtafevgyaaalnkmvltftsdrrnmrekygsevdkdnlrvegfglpfnlmly dgvevfdsfesafkyflanfpsk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.20581
    Matthews' coefficent 2.70 Rfactor 0.17301
    Waters 416 Solvent Content 54.50

    Ligand Information
    Ligands SO4 (SULFATE) x 2;GOL (GLYCEROL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch