The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of 6-pyruvoyl tetrahydropterin synthase (PTPS) from Plasmodium vivax at 2.2 A resolution. To be Published
    Site SGPP
    PDB Id 2a0s Target Id Pviv004546AAA
    Molecular Characteristics
    Source Plasmodium vivax
    Alias Ids TPS14910,PV114505 Molecular Weight 20959.83 Da.
    Residues 180 Isoelectric Point 6.25
    Sequence mahhhhhhmnphpveprdqiaellvesplfsfncahfiafkgfretlhghnynvslrlrgniqgdgyvi dfsilkekvrkvckqldhhfilpmysdvlniqevndnfkitcednseysfpkrdcvqipikhssteeig lyilnqlieeidlpflktrsvnymevtvsespsqkatvhrni
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.24575
    Matthews' coefficent 3.10 Rfactor 0.20838
    Waters 186 Solvent Content 60.10

    Ligand Information
    Ligands BIO (BIOPTERIN) x 2
    Metals ZN (ZINC) x 2



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch