.
The Open Protein Structure Annotation Network
PDB Keyword
.

2a0u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the eukaryotic initiation factor 2B from Leishmania major at 2.1 A resolution. To be Published
    Site SGPP
    PDB Id 2a0u Target Id Lmaj006238AAA
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14905,LMJF36.4930 Molecular Weight 41441.12 Da.
    Residues 383 Isoelectric Point 6.36
    Sequence mahhhhhhmmskphhatlesikytpgslrlldqrklpletvfddvltvediwsaikemrvrgapaiavs aalgiavatqrkaangelksgrevqtflltscdfvmtsrptavnlfnclrdlkaqvdkldptkaaaeva qafvelaeavytndvafnegimrhgaahilaaakaegrdkvsilticntgalatsrygtalgvvrqlfy dgklervyacetrpwnqgarltvyecvqedipctlicdgaasslmlnrkidavvvgadricqngdtank igtynlavsakfhgvklyvaaptttldvktasgnhveieerepteittnlvtkqrvvadgphlsiwnpv fditpselitggiitekgvqapaasapyydiasiiaqa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.26378
    Matthews' coefficent 2.00 Rfactor 0.21392
    Waters 308 Solvent Content 38.10

    Ligand Information
    Ligands SO4 (SULFATE) x 10
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch