.
The Open Protein Structure Annotation Network
PDB Keyword
.

2amh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Maf-like Protein Tbru21784AAA from T.brucei. To be Published
    Site SGPP
    PDB Id 2amh Target Id Tbru021784AAA
    Molecular Characteristics
    Source Trypanosoma brucei
    Alias Ids TPS14902,TB11.01.5890 Molecular Weight 22608.52 Da.
    Residues 207 Isoelectric Point 5.48
    Sequence gpgsmaeeirtmiigtssafranvlrehfgdrfrnfvllppdidekayraadpfeltesiarakmkavl ekarqhsppisgpaialtfdqvvvkgdevrekplsteqcrsfiasysgggvrtvatyalcvvgtenvlv ahnetetffskfgddivertlergacmnsagglvvededmsrhvvrivgtsygvrgmepavvekllsql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.231
    Matthews' coefficent 2.50 Rfactor 0.197
    Waters 86 Solvent Content 50.00

    Ligand Information
    Ligands SO4 (SULFATE) x 2
    Metals MN (MANGANESE) x 3

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch