.
The Open Protein Structure Annotation Network
PDB Keyword
.

2b4r

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of glyceraldehyde-3-phosphate dehydrogenase from Plasmodium falciparum at 2.25 A resolution reveals intriguing extra electron density in the active site. Proteins 62 570-577 2006
    Site SGPP
    PDB Id 2b4r Target Id Pfal007254AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14895,PF14_0598 Molecular Weight 37658.39 Da.
    Residues 345 Isoelectric Point 7.66
    Sequence mahhhhhhmavtklgingfgrigrlvfraafgrkdievvaindpfmdlnhlcyllkydsvhgqfpcevt hadgflligekkvsvfaekdpsqipwgkcqvdvvcestgvfltkelasshlkggakkvimsappkddtp iyvmginhhqydtkqlivsnascttnclaplakvindrfgiveglmttvhastanqlvvdgpskggkdw ragrcalsniipastgaakavgkvlpelngkltgvafrvpigtvsvvdlvcrlqkpakyeevaleikka aegplkgilgytedevvsqdfvhdnrssifdmkaglalndnffklvswydnewgysnrvldlavhitnn
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.25 Rfree 0.2428
    Matthews' coefficent 2.10 Rfactor 0.18282
    Waters 257 Solvent Content 40.60

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 4;AES (4-(2-AMINOETHYL)BENZENESULFONYL) x 3;GOL (GLYCEROL) x 4
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch