The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of an orotidine-5'-monophosphate decarboxylase homolog from Plasmodium falciparum. To be Published
    Site SGPP
    PDB Id 2f84 Target Id Pfal000304AAA
    Molecular Characteristics
    Source Plasmodium falciparum
    Alias Ids TPS14889,PF10_0225 Molecular Weight 38847.52 Da.
    Residues 331 Isoelectric Point 7.58
    Sequence mahhhhhhmgfkvklekrrnaintclcigldpdekdienfmknekennynnikknlkekyinnvsikkd illkapdniireekseeffyffnhfcfyiinetnkyaltfkmnfafyipygsvgidvlknvfdylyeln iptildmkindigntvknyrkfifeylksdsctvniymgtnmlkdicydeeknkyysafvlvkttnpds aifqknlsldnkqayvimaqealnmssylnleqnnefigfvvgansydemnyirtyfpncyilspgiga qngdlhktltngyhksyekilinigraitknpypqkaaqmyydqinailkqnmes
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.288
    Matthews' coefficent 2.25 Rfactor 0.227
    Waters 120 Solvent Content 45.43

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch