.
The Open Protein Structure Annotation Network
PDB Keyword
.

2gzq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of Plasmodium vivax phosphatidylethanolamine-binding protein suggests a functional motif containing a left-handed helix. Acta Crystallogr.,Sect.F 63 178-182 2007
    Site SGPP
    PDB Id 2gzq Target Id Pviv009166AAA
    Molecular Characteristics
    Source Plasmodium vivax
    Alias Ids TPS14911,PV123630 Molecular Weight 22672.88 Da.
    Residues 199 Isoelectric Point 7.18
    Sequence mahhhhhhmggpptieelkrekiiphvfpdenvdltvdmyisfksgkevnhgnildlagtgsvprnikf seeppedycyilfmidpdfpsrrrpdgrdyvhwavsgikskelvkgtdkncitllpyvgpsikkgtglh risfilslvkeenkgnvtgvplyrgehyitrvkfnncqsaynviqmndmkivgfnwcqiea
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.30 Rfree 0.18
    Matthews' coefficent 2.15 Rfactor 0.161
    Waters 282 Solvent Content 42.86

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch