The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Cyclophilin from Leishmania major. To be Published
    Site SGPP
    PDB Id 2hqj Target Id Lmaj007771BAB
    Molecular Characteristics
    Source Leishmania major
    Alias Ids TPS14886,LMJF23.0050 Molecular Weight 19440.97 Da.
    Residues 183 Isoelectric Point 9.39
    Sequence gpgsmtnpkvffdisidnkaagrivmelyadtvpktaenfralctgekgkgrsgkplhykssvfhrvip nfmiqggdftrgngtggesiygttfrdesfsgkagrhtglgclsmanagpntngsqffictaatpwldg khvvfgrvidgldvvkkverlgsssgktrsrivvsdcgevaadks
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.239
    Matthews' coefficent 2.48 Rfactor 0.191
    Waters 122 Solvent Content 50.38

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch