.
The Open Protein Structure Annotation Network
PDB Keyword
.

2q0x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of a Trypanosoma brucei alpha/beta-hydrolase fold protein with unknown function. Acta Crystallogr.,Sect.F 64 474-478 2008
    Site SGPP
    PDB Id 2q0x Target Id Tbru020260AAA
    Molecular Characteristics
    Source Trypanosoma brucei
    Alias Ids TPS14901,TB10.6K15.0140 Molecular Weight 37310.37 Da.
    Residues 335 Isoelectric Point 5.29
    Sequence gpgsmyrsrpepvqghlftyykdpyckipvfmmnmdarrcvlwvggqtesllsfdyftnlaeelqgdwa fvqvevpsgkigsgpqdhahdaedvddligillrdhcmnevalfatstgtqlvfellensahkssitrv ilhgvvcdpenplftpegcaarkehveklmaegrgedslamlkhydipitparlagggfptlqeavwnp cirkefdvlrrsvgvikvplllmlahnvqykpsdeevgtvlegvrdhtgcnrvtvsyfndtcdelrrvl kaaesehvaailqfladedefrteteknnrikaaedekkrksvlqvssfaqaassvkas
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.250
    Matthews' coefficent 2.36 Rfactor 0.206
    Waters 123 Solvent Content 39.90

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch