The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title High-resolution structure of the histidine-containing phosphocarrier protein (HPr) from Staphylococcus aureus and characterization of its interaction with the bifunctional HPr kinase/phosphorylase. J.Bacteriol. 186 5906-5918 2004
    Site SPINE
    PDB Id 1ka5 Target Id REGEN_HPr_Sa
    Molecular Characteristics
    Source Staphyloccocus aureus
    Alias Ids TPS23859, Molecular Weight 9495.20 Da.
    Residues 88 Isoelectric Point 4.50
    Sequence meqnsyviidetgiharpatmlvqtaskfdsdiqleyngkkvnlksimgvmslgvgkdaeitiyadgsd esdaiqaisdvlskegltk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch