.
The Open Protein Structure Annotation Network
PDB Keyword
.

1kv6

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and Functional Evidence for Ligand-Independent Transcriptional Activation by the Estrogen-Related Receptor 3. Mol.Cell 9 303-313 2002
    Site SPINE
    PDB Id 1kv6 Target Id IGBMC-0019-000
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23878,O75454 Molecular Weight 51303.20 Da.
    Residues 458 Isoelectric Point 6.04
    Sequence mdsvelclpesfslhyeeellcrmsnkdrhidsscssfiktepsspasltdsvnhhspggssdasgsys stmnghqngldspplypsapilggsgpvrklyddcsstivedpqtkceymlnsmpkrlclvcgdiasgy hygvasceackaffkrtiqgnieyscpatneceitkrrrkscqacrfmkclkvgmlkegvrldrvrggr qkykrridaenspylnpqlvqpakkpynkivshllvaepekiyampdptvpdsdikalttlcdladrel vviigwakhipgfstlsladqmsllqsawmeililgvvyrslsfedelvyaddyimdedqsklaglldl nnailqlvkkyksmklekeefvtlkaialansdsmhiedveavqklqdvlhealqdyeagqhmedprra gkmlmtlpllrqtstkavqhfyniklegkvpmhklflemleakv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.2674
    Matthews' coefficent 4.04 Rfactor 0.2328
    Waters 31 Solvent Content 69.30

    Ligand Information
    Ligands HIS-LYS-ILE-LEU-HIS-ARG-LEU-LEU-GLN-GLU x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch