.
The Open Protein Structure Annotation Network
PDB Keyword
.

1lbd

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of the ligand-binding domain of the human nuclear receptor RXR-alpha. Nature 375 377-382 1995
    Site SPINE
    PDB Id 1lbd Target Id IGBMC-0017-000
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS23876,P19793 Molecular Weight 50808.53 Da.
    Residues 462 Isoelectric Point 7.92
    Sequence mdtkhflpldfstqvnssltsptgrgsmaapslhpslgpgigspgqlhspistlsspingmgppfsvis spmgphsmsvpttptlgfstgspqlsspmnpvsssedikpplglngvlkvpahpsgnmasftkhicaic gdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryqkclamgmkreavqe erqrgkdrnenevestssanedmpverileaelavepktetyveanmglnpsspndpvtnicqaadkql ftlvewakriphfselplddqvillragwnelliasfshrsiavkdgillatglhvhrnsahsagvgai fdrvltelvskmrdmqmdktelgclraivlfnpdskglsnpaevealrekvyasleayckhkypeqpgr faklllrlpalrsiglkclehlfffkligdtpidtflmemleaphqmt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.70 Rfree 0.3230000
    Matthews' coefficent 3.10 Rfactor 0.2300000
    Waters Solvent Content 55.00

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch