The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystallographic and Biochemical Studies of DivK Reveal Novel Features of an Essential Response Regulator in Caulobacter crescentus. J.Biol.Chem. 277 42003-42010 2002
    Site SPINE
    PDB Id 1mb3 Target Id IGBMC-1121-000
    Related PDB Ids 1m5t 1m5u 1mav 1mb0 
    Molecular Characteristics
    Source Caulobacter crescentus
    Alias Ids TPS23899,Q9A5I4 Molecular Weight 14714.31 Da.
    Residues 130 Isoelectric Point 4.98
    Sequence mvgvrmtkkvlivednelnmklfhdlleaqgyetlqtreglsalsiarenkpdlilmdiqlpeisglev tkwlkedddlahipvvavtafamkgdeerireggceayiskpisvvhfletikrllerqpa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.41 Rfree 0.215
    Matthews' coefficent 1.80 Rfactor 0.207
    Waters 63 Solvent Content 31.00

    Ligand Information
    Metals MG (MAGNESIUM) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch