The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Phosphorylation Domain in PhoP Reveals a Functional Tandem Association Mediated by an Asymmetric Interface. J.BACTERIOL. 185 254-261 2003
    Site SPINE
    PDB Id 1mvo Target Id IGBMC-1123-000
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS23901,P13792 Molecular Weight 27681.56 Da.
    Residues 240 Isoelectric Point 5.26
    Sequence mnkkilvvddeesivtllqynlersgydvitasdgeealkkaetekpdlivldvmlpkldgievckqlr qqklmfpilmltakdeefdkvlglelgaddymtkpfsprevnarvkailrrseirapssemkndemegq ivigdlkilpdhyeayfkesqleltpkefelllylgrhkgrvltrdlllsavwnydfagdtrivdvhis hlrdkienntkkpiyiktirglgykleepkmne
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.232
    Matthews' coefficent 2.26 Rfactor 0.186
    Waters 174 Solvent Content 45.65

    Ligand Information
    Metals NA (SODIUM) x 2;MN (MANGANESE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch