.
The Open Protein Structure Annotation Network
PDB Keyword
.

1naq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The evolutionarily conserved trimeric structure of CutA1 proteins suggests a role in signal transduction. J.Biol.Chem. 278 45999-46006 2003
    Site SPINE
    PDB Id 1naq Target Id CIRMMP03
    Molecular Characteristics
    Source Eschericia coli
    Alias Ids TPS23924,2121103 Molecular Weight 12330.40 Da.
    Residues 112 Isoelectric Point 4.85
    Sequence mldekssntasvvvlctapdeataqdlaakvlaeklaacatlipgatslyywegkleqeyevqmilktt vshqqalleclkshhpyqtpellvlpvthgdtdylswlnaslr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 6
    Resolution (Å) 1.70 Rfree 0.2554
    Matthews' coefficent 2.07 Rfactor 0.2025
    Waters 343 Solvent Content 40.56

    Ligand Information
    Ligands MBO (MERCURIBENZOIC) x 10
    Metals HG (MERCURY) x 8

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch