The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Ligand-Binding Face of the Semaphorins Revealed by the High-Resolution Crystal Structure of Sema4D. Nat.Struct.Biol. 10 843 2003
    Site SPINE
    PDB Id 1olz Target Id OPTIC7164
    Molecular Characteristics
    Source Homo sapiens
    Alias Ids TPS14924,Q92854 Molecular Weight 96144.76 Da.
    Residues 862 Isoelectric Point 8.25
    Sequence mrmctpirgllmalavmfgtamafapipritwehrevhlvqfhepdiynysalllsedkdtlyigarea vfavnalnisekqhevywkvsedkkakcaekgkskqteclnyirvlqplsatslyvcgtnafqpacdhl nltsfkflgknedgkgrcpfdpahsytsvmvdgelysgtsynflgsepiisrnsshsplrteyaipwln epsfvfadvirkspdspdgeddrvyffftevsveyefvfrvlipriarvckgdqgglrtlqkkwtsflk arlicsrpdsglvfnvlrdvfvlrspglkvpvfyalftpqlnnvglsavcaynlstaeevfshgkymqs ttveqshtkwvryngpvpkprpgacidsearaanytsslnlpdktlqfvkdhplmddsvtpidnrprli kkdvnytqivvdrtqaldgtvydvmfvstdrgalhkaislehavhiieetqlfqdfepvqtlllsskkg nrfvyagsnsgvvqaplafcgkhgtcedcvlardpycawspptatcvalhqtespsrgliqemsgdasv cpdkskgsyrqhffkhggtaelkcsqksnlarvfwkfqngvlkaespkyglmgrknllifnlsegdsgv yqclseervknktvfqvvakhvlevkvvpkpvvaptlsvvqtegsriatkvlvastqgsspptpavqat ssgaitlppkpaptgtscepkivintvpqlhsektmylkssdnrllmslflfffvlflclffyncykgy lprqclkfrsalligkkkpksdfcdreqslketlvepgsfsqqngehpkpaldtgyeteqdtitskvpt dredsqriddlsardkpfdvkcelkfadsdadgd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.0 Rfree 0.270
    Matthews' coefficent Rfactor 0.206
    Waters 841 Solvent Content 57

    Ligand Information



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch