.
The Open Protein Structure Annotation Network
PDB Keyword
.

1on4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Solution Structure of Sco1: A Thioredoxin-like Protein Involved in Cytochrome c Oxidase Assembly. STRUCTURE 11 1431-1433 2003
    Site SPINE
    PDB Id 1on4 Target Id CIRMMP02
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS23921,1730937 Molecular Weight 19833.37 Da.
    Residues 174 Isoelectric Point 4.76
    Sequence hmleikdplnyevepftfqnqdgknvsleslkgevwladfiftnceticppmtahmtdlqkklkaenid vriisfsvdpendkpkqlkkfaanyplsfdnwdfltgysqseieefalksfkaivkkpegedqvihqss fylvgpdgkvlkdyngventpyddiisdvksastlk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch