.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ot4

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title A Strategy for the NMR Characterization of Type II Copper(II) Proteins: the Case of the Copper Trafficking Protein CopC from Pseudomonas Syringae. J.Am.Chem.Soc. 125 7200-7208 2003
    Site SPINE
    PDB Id 1ot4 Target Id CIRMMP01
    Related PDB Ids 1nm4 
    Molecular Characteristics
    Source Pseudomonas syringae
    Alias Ids TPS23919,30749645 Molecular Weight 10306.23 Da.
    Residues 100 Isoelectric Point 7.10
    Sequence hpklvsstpaegsegaapakielhfsenlvtqfsgaklvmtampgmehspmavkaavsgggdpktmvit paspltagtykvdwravssdthpitgsvtfk
      BLAST   FFAS

    Structure Determination
    Method NMR Chains 1

    Ligand Information
    Ligands
    Metals CU (COPPER) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch